The short version of NADH fits in a sentence. The long version — which is the one that helps — is below.
This page was last updated on 2025-11-18 and is reviewed periodically as new material appears.
Cells produce NAD+ through several biosynthetic routes. The salvage pathway recycles nicotinamide, while the Preiss-Handler pathway uses nicotinic acid, and a de novo route can start from tryptophan in some organisms. In mammals, the salvage pathway is generally considered the main source under ordinary conditions. Tissue concentrations vary widely by cell type and compartment, and measured declines with age have been reported in some studies. Whether such changes drive aging or mainly accompany it remains an open question.
Nicotinamide adenine dinucleotide, commonly abbreviated NAD+, is a coenzyme present in all living cells. The molecule consists of two nucleotides linked by phosphate groups, with adenine and a nicotinamide ring as its principal features. In its oxidized form, the nicotinamide ring can accept a hydride ion, becoming NADH. This reversible conversion places NAD+ at the center of many electron-transfer reactions. Its role as a redox carrier is well established across bacteria, plants, fungi, and animals.
Beyond redox chemistry, NAD+ acts as a substrate for several enzyme families. ADP-ribosyltransferases, sirtuins, and CD38 ectoenzymes cleave the molecule into nicotinamide and ADP-ribose or related products. These reactions connect NAD+ availability to processes such as DNA repair, chromatin modification, and calcium signaling. Because the coenzyme is used in both electron transfer and signaling, cells maintain separate pools in compartments including the cytosol, mitochondria, and nucleus. The relative sizes and regulation of those pools remain active areas of study.
In redox reactions, NAD+ accepts a hydride ion, which consists of two electrons and one proton. The hydride adds to the nicotinamide ring at a specific carbon, converting NAD+ into NADH. Dehydrogenase enzymes use this step in glycolysis, the citric acid cycle, and fatty acid oxidation. NADH later donates electrons to the mitochondrial electron transport chain, helping to drive ATP synthesis. The balance between NAD+ and NADH reflects the metabolic state of a cell, and shifts in that balance can alter how pathways operate.
Beyond electron transfer, NAD+ serves as a substrate for enzymes that cleave it and attach its ADP-ribose portion to other molecules. This group includes poly(ADP-ribose) polymerases, CD38, and sirtuins. Such reactions consume NAD+ and can influence its availability for metabolism. Cells replenish NAD+ through a salvage pathway that recycles nicotinamide and through routes starting from tryptophan or vitamin B3 forms. How these synthesis and consumption routes are coordinated across tissues remains an active area of study, and compartment-specific concentrations are difficult to measure directly.
| Property | Value | Notes |
|---|---|---|
| Chemical formula | C21H27N7O14P2 | Oxidized free acid form; charge depends on pH. |
| Molar mass | 663.43 g/mol | Calculated for the free acid. |
| CAS Registry Number | 53-84-9 | For the anhydrous free acid; salts have different identifiers. |
| Appearance | White to off-white powder | Solid material; hygroscopic. |
| Solubility | Water-soluble | Dissolves in aqueous buffers; solubility varies with pH and salt. |
Measuring NAD+ in biological samples requires care because the molecule is chemically reactive and present at low concentrations in some tissues. Common approaches include enzymatic cycling assays, high-performance liquid chromatography, and liquid chromatography coupled to mass spectrometry. Each method has different sensitivity and specificity, and sample preparation can affect results. Acidic or alkaline extraction steps are used in some protocols, but the choice depends on the analyte and matrix. No single method is universally optimal for every tissue or fluid.
Solid NAD+ is relatively stable when kept dry, cold, and protected from light. Aqueous solutions are more vulnerable to hydrolysis and can lose activity during repeated freeze-thaw cycles or prolonged storage at ambient temperature. Stability depends on pH, ionic strength, and the presence of degrading enzymes or metal ions. For many laboratory uses, aliquots are stored frozen and thawed only once. Exact degradation rates vary by matrix, so stability should be checked for each application rather than assumed.
Laboratory measurement of NAD+ usually begins with rapid sample quenching because the molecule can change form after collection. Enzymatic cycling assays amplify signal through coupled reactions and are suited to small samples. High-performance liquid chromatography with ultraviolet detection separates NAD+ from related nucleotides. Liquid chromatography-mass spectrometry offers higher specificity and can distinguish NAD+ from close analogs. Each method has trade-offs in sensitivity, throughput, and equipment needs, so reported values depend heavily on extraction and detection choices.
Stability of NAD+ depends on form, temperature, pH, and water content. The solid is generally more stable than solutions, and it should be kept dry and cold. In solution, hydrolysis can cleave the dinucleotide, especially under alkaline conditions or at elevated temperature. Light exposure may also contribute to degradation. Buffers, chelating agents, and sterile handling can reduce losses, but no single condition preserves all preparations indefinitely. Researchers often prepare working solutions shortly before use and verify activity or purity after storage.
Quality control for NAD+ relies on identity, purity, and functional tests. A certificate of analysis may report high-performance liquid chromatography purity, ultraviolet spectrum, water content, and residual solvents. Because NAD+ is hygroscopic, gravimetric values can shift as material absorbs water, so purity should be interpreted alongside storage history. Mass spectrometry confirms molecular identity, while enzymatic assays show whether the material supports dehydrogenase activity. Commercial material is available as the free acid and as salts, and the counterion affects molecular weight, solubility, and how concentrations are calculated.
===== Asia ===== Israel - DMT is an illegal substance; production, trade, and possession are prosecuted as crimes. India - DMT is illegal to produce, transport, trade in, or possess with a minimum prison or jail punishment of ten years.
=== Other reactions === A radical SAM enzyme with intrinsic lyase activity is able to catalyze lysine transfer reaction, generating archaea-specific archaosine-containing tRNAs. Viperin is an interferon-stimulated radical SAM enzyme which converts CTP to ddhCTP (3ʹ-deoxy-3′,4ʹdidehydro-CTP), which is a chain terminator for viral RdRps and therefore a natural antiviral compound.
== Cast and characters == Shun Oguri as Kenji Okamoto, a police detective who was suspended for allowing his former love interest and reporter, Kyoko access to case documents. His suspension was lifted by the Superintendent General in order to investigate brutal murder on live television program case caused by the Human Vapor, later leads him uncover hidden crimes and conspiracies involving the yakuza, the police and the government. Yū Aoi as Kyoko Kono, a reporter and Kenji's former love interest who received a promotion after reporting on a story using his case files. After witnessing a brutal murder on stage, she joins with Kenji in pursuing the truth. Suzu Hirose as Kaho Fujikawa and Kento Hayashi as Fujita Fujikawa, a pair of sibling livestreamers who run a horror and urban-myth webseries titled "Fujita and Kaho's Terror Zone". Only Fujita appears onscreen during their livestreams, as Kaho is insecure about a birthmark which covers half of her face. Their streams regularly attract only a handful of viewers, much to Fujita's frustrations. Uta as Ren Tsutsumida, the Human Vapor. One of many victims of the White Center's experiments, he vanished for a long time before resurfacing to exact revenge. Yutaka Takenouchi as Yasutoshi Mori, a former yakuza member turned company president, and one of the leaders of the White Center.
=== Enzyme production === A significant milestone in the use of K. phaffii in food technology was its GRAS classification by the US Food and Drug Administration, alongside their approval of recombinant proteins. It is now used to produce various enzymes that serve as processing aids and food additives. In bakery production, enzymes produced by genetically modified Komagataella can maintain bread freshness and compensate for variations in flour and malt quality. In brewing, they can reduce beer's alcohol content or modify the flavour and filtration properties of wine. Recombinant expressed phospholipase C is used to degum high-phosphorus vegetable oils by hydrolysing phospholipids. In animal feed, phytase produced by K. phaffii breaks down phytic acid, an antinutrient. Recently, K. phaffii has been used increasingly to produce soy leghemoglobin, a plant heme protein that gives plant-based meat analogues their colour and flavour. This expands the industrial application of K. phaffii from technical enzymes towards functional food ingredients. For this purpose, the yeast utilises its strong methanol-inducible promoters and efficient secretion to produce functional leghemoglobin for use as a food ingredient. Through strain engineering, including optimisation of heme biosynthesis and signal peptides, and controlled fed-batch fermentation, gram-per-litre titres of secreted leghemoglobin have been achieved. This makes large-scale production for meat analogues economically viable.
Sources: en.wikipedia.org
=== EC 1.3.7 With an iron–sulfur protein as acceptor === EC 1.3.7.1: 6-hydroxynicotinate reductase EC 1.3.7.2: 15,16-dihydrobiliverdin:ferredoxin oxidoreductase EC 1.3.7.3: phycoerythrobilin:ferredoxin oxidoreductase EC 1.3.7.4: phytochromobilin:ferredoxin oxidoreductase EC 1.3.7.5: phycocyanobilin:ferredoxin oxidoreductase EC 1.3.7.6: phycoerythrobilin synthase EC 1.3.7.7: ferredoxin:protochlorophyllide reductase (ATP-dependent) EC 1.3.7.8: benzoyl-CoA reductase EC 1.3.7.9: 4-hydroxybenzoyl-CoA reductase EC 1.3.7.10: pentalenolactone synthase EC 1.3.7.15: chlorophyllide a reductase
== Mode of action == Like other macrolides, tylosin has a bacteriostatic effect on susceptible organisms, caused by inhibition of protein synthesis through binding to the 50S subunit of the bacterial ribosome.
Lepirudin is an anticoagulant that functions as a direct thrombin inhibitor. Brand name: Refludan, Generic: Lepirudin rDNA for injection. Lepirudin is a recombinant hirudin derived from yeast cells. Lepirudin is almost identical to hirudin extracted from Hirudo medicinalis, having the amino acid sequence LTYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ with disulfide bridges at Cys6-Cys14, Cys16-Cys28 and Cys22-Cys39, and differs from by the substitution of leucine for isoleucine at the N-terminal end of the molecule and the absence of a sulfate group on the tyrosine at position 63. Lepirudin may be used as an anticoagulant when heparins (unfractionated or low-molecular-weight) are contraindicated because of heparin-induced thrombocytopenia.
Sources: en.wikipedia.org
NAD+ is a coenzyme found in living cells and is the oxidized form of nicotinamide adenine dinucleotide. It accepts electrons in redox reactions and also serves as a substrate for certain signaling and repair enzymes.
NAD+ becomes NADH when it accepts a hydride ion during oxidation-reduction reactions. NADH then donates electrons to other molecules, after which the carrier can return to the NAD+ form.
No, nicotinamide is a smaller molecule and a component of NAD+. Cells can use nicotinamide to rebuild NAD+ through the salvage pathway.
It indicates the oxidized form, which has a positive charge on the nicotinamide nitrogen. The reduced partner NADH lacks that charge and carries added electrons. The plus sign is part of the standard abbreviation, not a separate ion.