The short version of NADH fits in a sentence. The long version — which is the one that helps — is below.
Reviewed 2026-02-22. Anything still debated is marked as such rather than presented as settled.
Nicotinamide adenine dinucleotide, commonly abbreviated NAD+, is a coenzyme present in all living cells. The molecule consists of two nucleotides linked by phosphate groups, with adenine and a nicotinamide ring as its principal features. In its oxidized form, the nicotinamide ring can accept a hydride ion, becoming NADH. This reversible conversion places NAD+ at the center of many electron-transfer reactions. Its role as a redox carrier is well established across bacteria, plants, fungi, and animals.
Beyond redox chemistry, NAD+ acts as a substrate for several enzyme families. ADP-ribosyltransferases, sirtuins, and CD38 ectoenzymes cleave the molecule into nicotinamide and ADP-ribose or related products. These reactions connect NAD+ availability to processes such as DNA repair, chromatin modification, and calcium signaling. Because the coenzyme is used in both electron transfer and signaling, cells maintain separate pools in compartments including the cytosol, mitochondria, and nucleus. The relative sizes and regulation of those pools remain active areas of study.
In cells, NAD+ functions primarily as an electron carrier. Dehydrogenase enzymes in glycolysis and the citric acid cycle transfer hydride from substrates to NAD+, producing NADH. NADH then delivers electrons to the mitochondrial respiratory chain, supporting ATP synthesis. In fermentation, NADH is reoxidized to NAD+ so that glycolysis can continue. The balance between NAD+ and NADH helps set metabolic flux. Beyond redox, NAD+ serves as a substrate for enzymes that cleave it, including sirtuins, poly(ADP-ribose) polymerases, and CD38. These reactions consume NAD+ and release nicotinamide and ADP-ribose products.
Biosynthesis occurs through salvage, Preiss-Handler, and de novo pathways. In mammals, the salvage pathway from nicotinamide predominates, and NAMPT is often described as rate-limiting. Nicotinamide riboside and nicotinic acid enter related routes that converge on NAD+ production. Tissue NAD+ concentrations vary widely and are maintained by a balance of synthesis and consumption. Some studies report age-related declines in certain tissues, but whether these changes cause disease or can be reversed to improve human health remains an open question.
NAD+ stands for nicotinamide adenine dinucleotide, the oxidized form of a coenzyme found in all living cells. The molecule consists of two nucleotides, adenine and nicotinamide ribose, joined through phosphate groups. Its chemical formula is C21H27N7O14P2, and the free acid has a molar mass near 663.43 grams per mole. In redox reactions, NAD+ accepts a hydride ion and becomes NADH. The pair NAD+ and NADH participates in hundreds of metabolic reactions, including steps in glycolysis, the citric acid cycle, and oxidative phosphorylation.
| Property | Value | Notes |
|---|---|---|
| Chemical formula | C21H27N7O14P2 | Oxidized free acid form; charge depends on pH. |
| Molar mass | 663.43 g/mol | Calculated for the free acid. |
| CAS Registry Number | 53-84-9 | For the anhydrous free acid; salts have different identifiers. |
| Appearance | White to off-white powder | Solid material; hygroscopic. |
| Solubility | Water-soluble | Dissolves in aqueous buffers; solubility varies with pH and salt. |
Quantification of NAD+ in biological samples usually relies on separation techniques coupled to sensitive detection. High-performance liquid chromatography with ultraviolet detection can measure the oxidized form by its absorbance near 260 nm, while mass spectrometry provides greater specificity and can distinguish NAD+ from close analogs. Enzymatic cycling assays use coupled dehydrogenase reactions to amplify signal and estimate NAD+ concentrations in cell or tissue extracts. Because NAD+ and NADH interconvert rapidly, sample preparation must quench metabolism quickly and preserve the redox state before analysis.
The stability of NAD+ depends on pH, temperature, light exposure, and the presence of degradative enzymes. Aqueous solutions are generally more stable under mildly acidic to neutral conditions and degrade faster under alkaline conditions or prolonged heat. The solid is hygroscopic and should be stored desiccated, often frozen, and protected from repeated freeze-thaw cycles. In laboratory handling, aliquots reduce repeated temperature changes, and chelating agents may limit metal-catalyzed hydrolysis in some buffers. These practices matter because even small amounts of NADH or hydrolysis products can interfere with quantitative assays.
Quality control for NAD+ materials typically combines identity, purity, and water content checks. Identity may be confirmed by ultraviolet spectrum, retention time in chromatography, or mass accuracy, while purity is assessed by HPLC peak area or quantitative nuclear magnetic resonance. Residual water and solvents can affect molar calculations and enzyme assays, so Karl Fischer titration or thermogravimetric analysis may be used. Commercial materials vary in grade and counterion form, and published methods should specify the exact salt or hydrate when reporting concentrations. Regulatory status depends on intended use, with research reagents, dietary ingredients, and clinical products treated under different frameworks.
Measuring NAD+ in biological samples requires rapid processing because the compound can degrade or interconvert after collection. Common approaches include enzymatic cycling assays, high-performance liquid chromatography, and mass spectrometry. Each method has different sensitivity, specificity, and susceptibility to interference from related nucleotides. Sample type matters: cultured cells, animal tissues, and human blood present distinct challenges. Reported values can vary widely across laboratories because of differences in extraction, normalization, and analytical platform. Standardization remains an open issue in the field.
NAD+ is relatively unstable in aqueous solution, especially at neutral or alkaline pH and at elevated temperatures. It is typically stored dry, protected from light and moisture, and kept cold or frozen for long-term use. Solutions are often prepared fresh or buffered to mildly acidic pH to slow hydrolysis. Repeated freeze-thaw cycles can reduce integrity. Laboratories may verify concentration using ultraviolet absorbance at 259 nm or by enzymatic assay. These handling practices are general laboratory conventions rather than universal rules.
Research on NAD+ often examines changes with age, diet, exercise, and disease states, but causal relationships are difficult to establish. Some studies measure NAD+ levels, while others assess enzyme activity or downstream markers. In the literature, terms such as "NAD+ decline" and "NAD+ boosting" appear in both scientific and commercial contexts, sometimes without precise definitions. Whether changes in measured NAD+ directly produce health effects remains an open question. Results from cells, animals, and humans cannot be assumed to translate directly.
NAD+ is a dinucleotide composed of adenine, ribose, and nicotinamide moieties linked by phosphate groups. Its oxidized form carries a positive charge on the nicotinamide ring, which enables reversible hydride transfer. The molecule functions as a coenzyme in oxidoreductase reactions rather than as a dietary vitamin in its intact form. Cells maintain separate pools in cytoplasm, mitochondria, and nucleus. This compartmentalization allows distinct redox environments while preserving a shared chemical identity.
In glycolysis, NAD+ accepts electrons during the oxidation of glyceraldehyde-3-phosphate, forming NADH. The tricarboxylic acid cycle and fatty acid oxidation also generate NADH, which donates electrons to the mitochondrial electron transport chain. This flow supports ATP synthesis and helps maintain the redox balance of the cell. Other dehydrogenases use NAD+ as a cofactor for biosynthetic reductions and detoxification reactions. NADH is later reoxidized to sustain continued flux through these pathways.
Solid NAD+ is relatively stable when kept dry, cold, and protected from light. Aqueous solutions are more vulnerable to hydrolysis and can lose activity during repeated freeze-thaw cycles or prolonged storage at ambient temperature. Stability depends on pH, ionic strength, and the presence of degrading enzymes or metal ions. For many laboratory uses, aliquots are stored frozen and thawed only once. Exact degradation rates vary by matrix, so stability should be checked for each application rather than assumed.
Laboratory handling of NAD+ follows standard practices for hygroscopic fine chemicals. Personnel typically avoid inhalation and skin contact, use gloves and eye protection, and work in a ventilated area. Quality control may include ultraviolet absorbance at the nicotinamide maximum, chromatographic purity, water content, and identity confirmation by mass spectrometry. Because commercial preparations can contain counterions, residual solvents, or related nucleotides, a certificate of analysis helps verify the material. Researchers should confirm that the form supplied matches the intended assay.
Long, however, did not publish his experience until 1849, thereby denying himself much of the credit he deserved. With the beginnings of modern medicine the stage was set for physicians and surgeons to build a paradigm in which anesthesia became useful. On 10 December 1844, Gardner Quincy Colton held a public demonstration of nitrous oxide in Hartford, Connecticut. One of the participants, Samuel A. Cooley, sustained a significant injury to his leg while under the influence of nitrous oxide without noticing the injury. Horace Wells, a Connecticut dentist present in the audience that day, immediately seized upon the significance of this apparent analgesic effect of nitrous oxide. The following day, Wells underwent a painless dental extraction while under the influence of nitrous oxide administered by Colton. Wells then began to administer nitrous oxide to his patients, successfully performing several dental extractions over the next couple of weeks. William T. G. Morton, another New England dentist, was a former student and then-current business partner of Wells. He was also a former acquaintance and classmate of William Edward Clarke (the two had attended undergraduate school together in Rochester, New York). Morton arranged for Wells to demonstrate his technique for dental extraction under nitrous oxide general anesthesia at Massachusetts General Hospital, in conjunction with the prominent surgeon John Collins Warren. This demonstration, which took place on 20 January 1845, ended in failure when the patient cried out in pain in the middle of the operation.
HN MAPRGESCLLLLTSEIDLPVKRRA S1 MCHWAGGASNTGDARGDVFGKQAG S2 MGVKFFTLSTREFPSVQRAVPLWTNS S3 MLGYNFSSFPCGTISIAPGENFYRLYFIWVNGLAKVVW S4 MLEVMELVNRRGKICRVPETFFNLSL S5 MYCSEVGFCSEVAPTEIFNAGLWV S6 MLDQDIPMVQPLLKVRLEND
Pituicytes from the posterior pituitary are glial cells with characteristics in common to astrocytes. Tanycytes in the median eminence of the hypothalamus are a type of ependymal cell that descend from radial glia and line the base of the third ventricle. Connective tissue is found in between other tissues and comprises connective tissue proper and special connective tissue. Most types of connective tissue consists of three main components: elastic and collagen fibers, ground substance, and cells. Connective tissue membranes include the synovial membrane, which lines the inner surface of capsules of synovial joints, tendon sheaths, and synovial bursas. Connective tissue proper includes loose (or areolar) and dense (regular and irregular) connective tissue. Adipose (Latin adeps, adip-, fat) and reticular connective tissue are regarded by older sources as forms of loose connective tissue alongside areolar tissue, while some newer sources have termed them as forms of special connective tissue. Special connective tissue includes supportive connective tissue (bone and cartilage) and fluid connective tissue (blood and lymph). Epithelial tissue are protective tissue that form the glands and outermost layer of many organs, including the skin (epidermis), internal organs (mesothelium), blood and lymphatic vessels (endothelium), as well as specialised organs (e.g. olfactory, respiratory, intestinal, transitional, vaginal, germinal (female), and germinal (male) epithelia).
Supercritical carbon dioxide (sCO2) is a fluid state of carbon dioxide where it is held at or above its critical temperature and critical pressure. Carbon dioxide usually behaves as a gas in air at standard temperature and pressure (STP), or as a solid called dry ice when cooled and/or pressurised sufficiently. If the temperature and pressure are both increased from STP to be at or above the critical point for carbon dioxide, it can adopt properties midway between a gas and a liquid. More specifically, it behaves as a supercritical fluid above its critical temperature (304.128 K, 30.9780 °C, 87.7604 °F) and critical pressure (7.3773 MPa, 72.808 atm, 1,070.0 psi, 73.773 bar), expanding to fill its container like a gas but with a density like that of a liquid. Supercritical CO2 is becoming an important commercial and industrial solvent due to its role in chemical extraction, in addition to its relatively low toxicity and environmental impact. The relatively low temperature of the process and the stability of CO2 also allows compounds to be extracted with little damage or denaturing. In addition, the solubility of many extracted compounds in CO2 varies with pressure, permitting selective extractions.
Sources: en.wikipedia.org
Larry Hama took over Wolverine's solo series in 1990, and exerted a major influence on how Wolverine was depicted throughout the X-Men family of publications during his run. Hama commented that he "considered the Chris Claremont, Frank Miller, and Barry Windsor-Smith [Wolverine] stories to be canon" and "pretty much ignored everything else." From 1990 to 1992, the series was usually illustrated by Marc Silvestri, who contributed to the character's rising popularity; his work on Wolverine also established him as a star artist in the industry. In issues #48-50 (November 1991-January 1992), Hama delved into Wolverine's mysterious past in the Weapon X program, which was often highly convoluted and unreliable due to the false memories implanted by the program's designers. In 1992, he revisited the Japanese setting and characters of Claremont's and Miller's earlier limited series, ending the story with the poisoning of Mariko Yashida, Logan's lover, and her mercy killing at the hands of Wolverine. During the Fatal Attractions storyline, in X-Men #25 (October 1993), the adamantium in Wolverine's body is ripped out by Magneto, using his magnetic abilities. Writers Fabian Nicieza and Scott Lobdell were inspired by a suggestion of another Marvel writer, Peter David. The story arc reveals that Wolverine has natural bone claws, in contrast to previously established narrative continuity that his claws were entirely bionic. Wolverine himself is confused by this realization, and his healing factor is also greatly weakened by recovery from this extraordinary injury.
=== Metabolism === Ibutilide has a high systemic plasma clearance that closes to the hepatic blood flow (29mL/min/kg). Its metabolic pathway is via liver's cytochrome P450 system by isoenzymes other than CYP3A4 and CYP2D6 by which the heptyl side chain of ibutilide is oxidized. With eight metabolites are detected in the urine, however, only one is an active metabolite that shares the similar electrophysiologic property of the Class III antiarrhythmic agents. The plasma concentration of this metabolite is only less than 10% of ibutilide.
Later on, grandmothers can again provide more direct care for the infant. These techniques require the mother's commitment over a period of weeks or months. However, even when lactation is established, the supply may not be large enough to breastfeed exclusively. A supportive social environment improves the likelihood of success. As the mother's milk production increases, other feeding can decrease. Parents and other family members should watch the baby's weight gain and urine output to assess nutritional adequacy. A WHO manual for physicians and senior health workers, citing a 1992 source, states: "If a baby has been breastfeeding sometimes, the breastmilk supply increases in a few days. If a baby has stopped breastfeeding, it may take 1–2 weeks or more before much breastmilk comes." Induced lactation, also called adoptive lactation, is the process of starting breastfeeding in a woman who did not give birth. This usually requires the adoptive mother to take hormones and other drugs to stimulate breast development and promote milk production. In some cultures, breastfeeding an adoptive child creates milk kinship that builds community bonds across class and other hierarchical bonds.
Sources: en.wikipedia.org
=== Other psychoactive effects === Some psychedelics have been associated with other psychoactive effects in addition to their hallucinogenic effects. For example, psychedelics like LSD and DOM have been described as having mild stimulant and/or "psychic-energizing" (i.e., acute antidepressant) effects. Some psychedelics and related drugs, like DOET (low doses), Ariadne, and ASR-2001 (2CB-5PrO), have been investigated specifically for such effects. 2C-B has been said to have mild entactogenic effects at low doses. 5-MeO-DiPT and 5-MeO-MiPT have unique and unusual effects at typical doses including tactile and sexual enhancement, mild entactogenic effects, and only light hallucinogenic effects. Uniquely among psychedelics, LSD shows biphasic effects and two temporally distinct phases of effects, including an initial psychedelic state and a delayed "paranoid" or psychosis-like state. LSD's delayed second phase of effects is associated with dopamine D2-like receptor agonism, most likely due to the highly potent dopamine D4 receptor agonism of its metabolite 13-hydroxy-LSD. Some drugs, such as MDxx compounds like MDMA and MDA as well as α-alkyltryptamines like α-methyltryptamine (AMT), are entactogens and/or stimulants acting at monoamine transporters in addition to having varying degrees of psychedelic effects.
They had planned to wed in summer 2020 but postponed the event twice due to the COVID-19 pandemic. At her wedding, Alizée wore the 1980s wedding dress belonging to Carole Middleton, her mother-in-law. The couple welcomed their first child, Inigo Gabriel, on 21 September 2023.
The affirmative decision of the IRB that the clinical trial has been reviewed and may be conducted at the institution site within the constraints set forth by the IRB, the institution, good clinical practice (GCP), and the applicable regulatory requirements. (ICH E6) Approved drugs
Sources: en.wikipedia.org
NAD+ is a coenzyme found in living cells and is the oxidized form of nicotinamide adenine dinucleotide. It accepts electrons in redox reactions and also serves as a substrate for certain signaling and repair enzymes.
NAD+ becomes NADH when it accepts a hydride ion during oxidation-reduction reactions. NADH then donates electrons to other molecules, after which the carrier can return to the NAD+ form.
No, nicotinamide is a smaller molecule and a component of NAD+. Cells can use nicotinamide to rebuild NAD+ through the salvage pathway.
Nicotinamide adenine dinucleotide, with the plus sign indicating the oxidized form. It is a coenzyme present in all living cells. The reduced form is NADH.