methods-notes.peptides6155.com › Wiki › Storage, Testing, And Labeling — Explained

Storage, Testing, And Labeling — Explained

By Editorial Desk · published 2026-02-02 · last reviewed 2026-03-16 · Wiki

Spray drying raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.

Reviewed 2026-03-16. Anything still debated is marked as such rather than presented as settled.

Storage, Testing, And Labeling

Analytical testing for whey protein hydrolysate focuses on peptide size distribution, degree of hydrolysis, protein content, moisture, ash, and microbiological quality. Size-exclusion chromatography and mass spectrometry can characterize peptide profiles, while Kjeldahl or combustion methods estimate total nitrogen and protein. Amino acid analysis quantifies free and total amino acids. Because peptide mixtures are complex, no single method captures every property, and results can vary between laboratories. Standardized methods and reference materials help improve comparability, but full sequence-level characterization remains uncommon in routine quality control.

Regulatory treatment of whey protein hydrolysate depends on the country and intended use. In many jurisdictions it is regulated as a food ingredient or food for special dietary use, not as a drug. Labeling rules govern allergen statements, protein content claims, and ingredient names. Some markets have specific rules for infant formula ingredients, where hydrolysates may be used for particular dietary purposes. Regulations generally focus on safety, truthful labeling, and manufacturing standards rather than on therapeutic effects. Scientific questions about specific peptide activities remain an active area of research rather than a settled regulatory category.

Production and Quality Control

Commercial production begins with whey protein concentrate or isolate dissolved in water. A protease is added under controlled pH and temperature, and the reaction is stopped by heat or pH adjustment once a target degree of hydrolysis is reached. Membrane filtration, often ultrafiltration or diafiltration, removes enzymes and small solutes while retaining peptides. The liquid is then concentrated and spray-dried into a powder. Each step influences peptide length, mineral content, and flavor.

Quality control focuses on degree of hydrolysis, molecular weight distribution, protein content, moisture, ash, and microbial limits. Degree of hydrolysis is commonly calculated from the number of cleaved peptide bonds relative to total peptide bonds. Size-exclusion chromatography and mass spectrometry can describe peptide size ranges, while amino acid analysis quantifies composition. Standard methods from dairy science organizations are often used, though no single method captures every functional property. Results are therefore reported alongside processing conditions.

Whey-protein-hydrolysate at a glance

PropertyValueNotes
Moisture contentTypically below 6% for dry powdersHigher moisture can promote caking and degradation.
Water activityOften below 0.6Low water activity limits microbial growth.
Typical storage temperature15–25 °C (cool, dry)Avoid heat and humidity; follow label specifications.
Common analytical methodSize-exclusion chromatographyUsed to estimate peptide molecular weight distribution.
Common synonymHydrolyzed whey proteinNot identical to whey protein isolate or concentrate.

Composition and Production Background

Whey protein hydrolysate is a dairy ingredient made by treating whey protein concentrate or isolate with proteases that cleave peptide bonds. The resulting mixture contains shorter peptides and free amino acids than intact whey protein. Commercial products vary widely in average peptide length, residual intact protein, lactose, fat, and minerals. The term hydrolysate does not imply a single fixed composition, because enzyme choice, reaction time, pH, and temperature all shape the final peptide distribution. Products are often described by degree of hydrolysis, a percentage estimate of cleaved peptide bonds.

Production begins with pasteurized whey, which is concentrated and sometimes defatted or demineralized before hydrolysis. Food-grade proteases, such as trypsin, chymotrypsin, pepsin, or microbial enzymes, are added under controlled conditions. After a target degree of hydrolysis is reached, the enzymes are inactivated by heat or pH adjustment. The liquor is then clarified, concentrated, and dried, usually by spray drying. Ultrafiltration or diafiltration may remove residual enzymes, salts, or very small peptides, depending on the intended specification.

The peptide profile affects functional behavior more than the total protein content alone. Short peptides can be more soluble across a range of pH values and may form clearer solutions than intact whey proteins. Bitterness often rises with higher degrees of hydrolysis because certain hydrophobic peptides are exposed. Foaming, gelation, and heat stability also change as molecular size decreases. These functional shifts make hydrolysates useful in beverages, clinical nutrition, and specialty foods, though the exact relationship between peptide sequence and sensory or physical properties remains an active area of study.

Related pages on this site

Production and Analytical Control

Analytical control focuses on protein content, hydrolysis extent, molecular weight distribution, and residual intact protein. Kjeldahl or Dumas methods measure total nitrogen, while size-exclusion chromatography or mass spectrometry estimates peptide profiles. Sodium dodecyl sulfate polyacrylamide gel electrophoresis can show remaining intact proteins, though small peptides may not resolve. Enzyme-linked immunosorbent assays are used to assess residual allergenic proteins in some contexts. Because no single method captures all relevant features, manufacturers combine several assays and report values against internal specifications.

Stability depends on moisture, temperature, oxygen, and packaging. Powdered hydrolysate generally requires cool, dry storage and protection from humidity because peptides can absorb water and undergo Maillard reactions with residual lactose. Higher temperatures can increase bitterness, discoloration, and loss of solubility over time, while liquid hydrolysate formats are more perishable and may need refrigeration or preservatives. Shelf-life studies typically monitor moisture, color, pH, protein solubility, and microbial counts. Exact stability limits vary by peptide profile, packaging, and water activity, so general rules should be treated as approximate.

Composition And Production Basics

Whey protein hydrolysate is a dairy ingredient made by breaking peptide bonds in whey proteins. Enzymes such as proteases, or in some processes acid or heat, cleave the protein chains into shorter peptides and free amino acids. The starting material may be sweet whey, acid whey, whey protein concentrate, or whey protein isolate. Because raw materials and reaction conditions differ, the final mixture is not a single uniform substance. Its peptide profile, mineral content, and residual lactose depend on the source and the processing steps used.

Production typically begins with pasteurization and concentration of whey. A protease is added under controlled temperature and pH, and the reaction is stopped by heat or pH change when the target extent of cleavage is reached. Ultrafiltration or diafiltration may remove enzymes, salts, and small molecules. The liquid is then spray dried into a powder. Process parameters shape bitterness, solubility, and peptide size. Established control points include enzyme type, reaction time, and inactivation conditions. How these variables interact across large-scale batches remains an area of active process development.

Hydrolysates usually contain 70% to 90% protein on a dry basis, with variable ash, fat, and carbohydrate. Solubility in water is generally high over a broad pH range, though bitter notes can appear from exposed hydrophobic peptides. The powder tends to absorb moisture and may brown during prolonged warm storage. Applications span sports nutrition, clinical nutrition, infant formulas, and flavor systems. Regulatory status and labeling rules differ by country. A key open question is whether a given peptide profile reliably predicts functional or sensory behavior across different food matrices.

Notes from published material

Amino acids are organic compounds that contain both amino and carboxylic acid functional groups. Although over 500 amino acids exist in nature, by far the most important are the 22 α-amino acids incorporated into proteins. Only these 22 appear in the genetic code of life. Amino acids can be classified according to the locations of the core structural functional groups (alpha- (α-), beta- (β-), gamma- (γ-) amino acids, etc.); other categories relate to polarity, ionization, and side-chain group type (aliphatic, acyclic, aromatic, polar, etc.). In the form of proteins, amino-acid residues form the second-largest component (water being the largest) of human muscles and other tissues. Beyond their role as residues in proteins, amino acids participate in a number of processes such as neurotransmitter transport and biosynthesis. It is thought that they played a key role in enabling life on Earth and its emergence. Amino acids are formally named by the IUPAC-IUBMB Joint Commission on Biochemical Nomenclature in terms of the fictitious "neutral" structure shown in the illustration. For example, the systematic name of alanine is 2-aminopropanoic acid, based on the formula CH3−CH(NH2)−COOH. The Commission justified this approach as follows:

C4H2N2O4 + GSH → C4H3N2O4• + GS• C4H3N2O4• + GSH → C4H4N2O4 + GS• C4H4N2O4 + O2 → C4H3N2O4• + O2•− + H+ C4H3N2O4• + O2 → C4H2N2O4 + O2•− + H+ Because it selectively kills the insulin-producing beta-cells found in the pancreas, alloxan is used to induce diabetes in laboratory animals. This occurs most likely because of selective uptake of the compound due to its structural similarity to glucose as well as the beta-cell's highly efficient uptake mechanism (GLUT2). In addition, alloxan has a high affinity to SH-containing cellular compounds and, as a result, reduces glutathione content. Furthermore, alloxan inhibits glucokinase, a SH-containing protein essential for insulin secretion induced by glucose. Most studies have shown that alloxan is not toxic to the human beta-cell, even in very high doses, probably because of differing glucose uptake mechanisms in humans and rodents. Alloxan is, however, toxic to the liver and the kidneys in high doses, as these are tissues where the GLUT2 transporter is expressed in humans. Streptozotocin

An anticancer drug is coupled to an antibody that targets a specific tumor antigen (or protein) that, ideally, is only found in or on tumor cells. The biochemical reaction that occurs upon attaching triggers a signal in the tumor cell, which then absorbs, or internalizes, the antibody together with the linked cytotoxin. After the ADC is internalized, the cytotoxin kills the cancer. Their targeting ability was believed to limit side effects for cancer patients and to give a wider therapeutic window than other chemotherapeutic agents, although this promise hasn't yet been realized in the clinic. ADC technologies have been featured in many publications, including scientific journals.

Sources: en.wikipedia.org

Background from the literature

In addition, cysteine, tyrosine, and arginine are considered semiessential amino acids, and taurine a semi-essential aminosulfonic acid in children. Some amino acids are conditionally essential for certain ages or medical conditions. Essential amino acids may also vary from species to species. The metabolic pathways that synthesize these monomers are not fully developed. Amino acids are sometimes added to animal feed because some of the components of these feeds, such as soybeans, have low levels of some of the essential amino acids, especially of lysine, methionine, threonine, and tryptophan. Likewise amino acids are used to chelate metal cations in order to improve the absorption of minerals from feed supplements.

ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).

From the 17th century, and before modern developments in organic chemistry nomenclature, acetone was given many different names. They included "spirit of Saturn", which was given when it was thought to be a compound of lead and, later, "pyro-acetic spirit" and "pyro-acetic ester". Prior to the name "acetone" being coined by French chemists, it was named "mesit" (from the Greek μεσίτης, meaning mediator) by Carl Reichenbach, who also said that methyl alcohol consisted of mesit and ethyl alcohol. Names derived from mesit include mesitylene and mesityl oxide which were first synthesised from acetone. In 1839, the name "acetone" began to be used, because it was obtained from acetic acid. Unlike many compounds with the acet- prefix which have a 2-carbon chain, acetone has a 3-carbon chain. That has caused confusion because there can not be a ketone with 2 carbons. The prefix refers to acetone's relation to vinegar (acetum in Latin, also the source of the words "acid" and "acetic"), rather than its chemical structure.

Sources: en.wikipedia.org

Frequently asked questions

How should whey protein hydrolysate powder be stored?

It is generally stored in a sealed container in a cool, dry place away from strong odors. Moisture and heat can cause caking, flavor changes, and peptide degradation. Product-specific labels and stability data should guide actual storage conditions.

What tests are used for quality control?

Common tests measure moisture, water activity, protein content, ash, microbiological safety, and degree of hydrolysis. Peptide size distribution may be checked by chromatography. Not every batch receives full sequence-level analysis because such testing is complex and costly.

Does hydrolysate labeling mean a product is hypoallergenic?

Not necessarily, because hydrolysis can reduce the size of some allergenic proteins while residual allergenic sequences may remain depending on the process. Milk is still a major allergen, and labeling rules usually require milk allergen disclosure unless a specific exemption applies. The term hydrolysate alone does not establish hypoallergenicity.

How is degree of hydrolysis measured?

Degree of hydrolysis is often estimated by quantifying free amino groups or by titrating cleaved peptide bonds. It can also be inferred from molecular weight distribution using chromatography. Values are operationally defined, so comparisons require the same method and conditions.

Network